General Information

  • ID:  hor006057
  • Uniprot ID:  Q86UU9
  • Protein name:  Endokinin-C
  • Gene name:  TAC4
  • Organism:  Homo sapiens (Human)
  • Family:  Tachykinin family
  • Source:  Human
  • Expression:  Expressed at low levels in the uterus of both pregnant and non-pregnant women. Isoform 1 is found only in the adrenal gland and fetal liver. Isoform 2 is found in heart, liver, bone marrow, prostate, adrenal gland and testis. Isoform 3 and isoform 4 are e
  • Disease:  Diseases associated with TAC4 include Oliver-Mcfarlane Syndrome.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0031835 substance P receptor binding
  • GO BP:  GO:0006954 inflammatory response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007217 tachykinin receptor signaling pathway; GO:0008217 regulation of blood pressure; GO:1902093 positive regulation of flagellated sperm motility
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  KKAYQLEHTFQGLL
  • Length:  14(82-95)
  • Propeptide:  MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE
  • Signal peptide:  MLPCLALLLLMELSVCTVAG
  • Modification:  T14 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Endokinin-A induces thermal hyperalgesia and pain-related behavior such
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  TACR1
  • Target Unid:  P25103
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q86UU9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006057_AF2.pdbhor006057_ESM.pdb

Physical Information

Mass: 190802 Formula: C78H122N20O21
Absent amino acids: CDIMNPRSVW Common amino acids: L
pI: 9.26 Basic residues: 3
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: -56.43 Boman Index: -1587
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 90.71
Instability Index: 732.86 Extinction Coefficient cystines: 1490
Absorbance 280nm: 114.62

Literature

  • PubMed ID:  12716968
  • Title:  Characterization of the endokinins: human tachykinins with cardiovascular activity.
  • PubMed ID:  12383518
  • Title:  Identification, localization and receptor characterization of novel mammalian substance P-like peptides.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA p
  • PubMed ID:  12788812
  • Title:  
  • PubMed ID:  17101218
  • Title:  
  • PubMed ID:  17655832
  • Title:  
  • PubMed ID:  17437961
  • Title: